PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G14520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 200aa    MW: 21607.2 Da    PI: 4.6768
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G14520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.53.6e-131056248
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                   ien+ +r+ t+ +Rr g+  K +  S+LC++++ ++ f++ g++ +
  OB07G14520.1 10 LIENEKKRKATYKNRRDGLVQKVSQFSTLCGVDAFLVCFGPGGEVVT 56
                  59*****************************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.222161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-17161IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-13160IPR002100Transcription factor, MADS-box
CDDcd002663.61E-19365No hitNo description
PRINTSPR004041.4E-6323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-161156IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MPRTKLVLEL IENEKKRKAT YKNRRDGLVQ KVSQFSTLCG VDAFLVCFGP GGEVVTTWPP  60
GRPRRDAVPR PPMPPPALAA APLEFDQSIM SGTAFMDSNP YATTNIVHGG STATTAVLDD  120
HGQFLAAGAG YDDDLLAHDF AFAAGSGYDL EPRVSTAEVW PMNTLSDPVD GIAFQQQQND  180
PRELLPGRSS GSNLQDVFQN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3MJ701e-148J3MJ70_ORYBR; Uncharacterized protein
STRINGOB07G14520.11e-147(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.34e-11M-type_MADS family protein